PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.5G408700.1.p
Common NameLOC101782035, SETIT_002599mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family LBD
Protein Properties Length: 262aa    MW: 26802.1 Da    PI: 7.8357
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.5G408700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601383.2e-4333131199
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrrkC++dCv+apyfp ++p+kf  vh++FGasnv+kll++l++ +reda++sl+yeA++r+rdPvyG+vgvi+ lq++l+ql+
  Seita.5G408700.1.p  33 PCAACKFLRRKCQPDCVFAPYFPPDNPQKFVHVHRVFGASNVTKLLNELHPFQREDAVNSLAYEADMRLRDPVYGCVGVISILQHNLRQLQ 123
                         7****************************************************************************************** PP

              DUF260  92 aelallke 99 
                         ++la++k 
  Seita.5G408700.1.p 124 QDLARAKY 131
                         ***99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.72932133IPR004883Lateral organ boundaries, LOB
PfamPF031954.1E-4333129IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009799Biological Processspecification of symmetry
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009954Biological Processproximal/distal pattern formation
GO:0048441Biological Processpetal development
GO:0005654Cellular Componentnucleoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MASSVPAPSG SVITVASSSS SAAAAAVCGT GSPCAACKFL RRKCQPDCVF APYFPPDNPQ  60
KFVHVHRVFG ASNVTKLLNE LHPFQREDAV NSLAYEADMR LRDPVYGCVG VISILQHNLR  120
QLQQDLARAK YELSKYQAAA AAASASTGSN GGPQAMAEFI GNAMPNGAHN FINIGHSAAL  180
GSIGGSPAVF GQEQFANAQM LSRSYDGEPI ARLGINGGYE FGYSTAMGGA GGPVSGLGTL  240
GISPFLKSGT AGGDEKPSAG Q*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00211DAPTransfer from AT1G65620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY9406810.0AY940681.1 Zea mays ASYMMETRIC LEAVES2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970852.10.0PREDICTED: LOB domain-containing protein 6
SwissprotQ32SG31e-163LBD6_MAIZE; LOB domain-containing protein 6
TrEMBLK3XL260.0K3XL26_SETIT; Uncharacterized protein
STRINGSi002599m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22673895
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.45e-59LBD family protein